PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000215371
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 315aa    MW: 35297.4 Da    PI: 5.9885
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000215371genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY33.86.8e-11114141229
                    --SS-EEEEEEE--TT-SS-EEEEEE-S CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCts 29 
                    dDgy+WrKYGqK++k+s++p     C+s
  MDP0000215371 114 DDGYKWRKYGQKSIKNSPNPSPISVCSS 141
                    8*******************87777766 PP

2WRKY53.54.9e-171511882158
                    -EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
           WRKY  21 prsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                     rsYYrCt ++C++kk+vers+edp++++itYeg H h
  MDP0000215371 151 LRSYYRCTNPRCSAKKQVERSSEDPDTLIITYEGLHLH 188
                    69**********************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081122.056108191IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.1E-27109188IPR003657WRKY domain
SuperFamilySSF1182902.88E-21111188IPR003657WRKY domain
SMARTSM007747.8E-30113190IPR003657WRKY domain
PfamPF031069.5E-19114188IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MEESMAATWS DWSEEELVRE LLDNDSPLFV LPEEAVQSRA ASVFGKEAIN RFIPNVYSGP  60
TIQDIETALS VTTGTVQPQE LSNARLSLLE RGLSKVEHKY TLKIKSCGNG IMADDGYKWR  120
KYGQKSIKNS PNPSPISVCS SSGYEHSVLH LRSYYRCTNP RCSAKKQVER SSEDPDTLII  180
TYEGLHLHFA YPFFNLNNQA QNSTPPMKKT KKKTLDPQPE DQEREAQESP RSLTPDPVPD  240
LPPGPFPDRY QEFVKEERSS QGLLQDMVPF MIRNPKPTSA SSNSSCSSYR SSPTSPSSLS  300
WATSYFDVGI NHSFG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A2e-171121881371WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC4852901e-33KC485290.1 Jatropha curcas WRKY transcription factor 38 (WRKY38) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008369986.10.0PREDICTED: probable WRKY transcription factor 49
TrEMBLM5W2Y41e-148M5W2Y4_PRUPE; Uncharacterized protein
STRINGGLYMA07G16040.21e-100(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF71183449
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43290.19e-39WRKY DNA-binding protein 49